PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_532725AD5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 241aa    MW: 26955.2 Da    PI: 10.9012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_532725AD5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.6e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd +l+ +   +G+g+W++++++ g++R++k+c++r+ +yl
  Traes_4BL_532725AD5.1 14 KGPWTAEEDAKLLAYTSNHGTGNWTSVPQRAGLKRCGKSCRLRYTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding54.13.7e-1769110346
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Traes_4BL_532725AD5.1  69 NFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 110
                            89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24565IPR009057Homeodomain-like
PROSITE profilePS5129417.055961IPR017930Myb domain
SuperFamilySSF466892.75E-3011108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001674.51E-101661No hitNo description
PROSITE profilePS5129425.00362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-2466116IPR009057Homeodomain-like
SMARTSM007173.5E-1566114IPR001005SANT/Myb domain
CDDcd001675.34E-1269112No hitNo description
PfamPF002492.4E-1569110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTAE EDAKLLAYTS NHGTGNWTSV PQRAGLKRCG KSCRLRYTNY  60
LRPNLKHENF TQEEEELIVT LHAMLGSRWS LIANQLPGRT DNDVKNYWNT KLSKKLRQRG  120
IDPITHRPIA DLMQSIGTLA IRPPPSAAGA SSSSYLPVNP AAAPGLQPLH DDVKYHAVLN  180
QQQQQVITLL DADAPGAAAS PDHPLKXXRR RRRLRGGAAG RSWSVPGCRG RWWRSTRVWR  240
H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727360.0AK372736.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3010N13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558134.11e-114PREDICTED: myb-related protein Zm38-like
RefseqXP_006649927.11e-114PREDICTED: myb-related protein Zm38-like
SwissprotQ9XHV05e-66MYB80_ARATH; Transcription factor MYB80
TrEMBLW5E3F01e-177W5E3F0_WHEAT; Uncharacterized protein
STRINGOB03G23760.11e-114(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.16e-66myb domain protein 103
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]